DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klri1

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001012667.1 Gene:Klri1 / 503651 RGDID:1359344 Length:243 Species:Rattus norvegicus


Alignment Length:145 Identity:30/145 - (20%)
Similarity:57/145 - (39%) Gaps:33/145 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CPPKFH---RVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHAD-RKLRLFLQKQDALSGEN 123
            |.|..|   ..|.:.|.......||.|:...|::.|::|.:....|: ..|.||     .::|  
  Rat   127 CDPCSHDWIAFGNNFYLFFRGTKSWAESKSACEELNSHLLDIDSKAELENLLLF-----EING-- 184

  Fly   124 DPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSAR 188
               |:..    ..|:..||      |:::.::.....:     .:..:::|.....|   ::.|.
  Rat   185 ---WILV----KKNQTNWS------SSENETKLQHTLI-----DEKKNHSCRYLRGS---QFIAD 228

  Fly   189 PCSDKLRFICQ-HKM 202
            .||.|..:.|: :||
  Rat   229 DCSSKKPYACEFNKM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 24/127 (19%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Klri1NP_001012667.1 ITIM motif 1. /evidence=ECO:0000250|UniProtKB:P27812 16..21
ITIM motif 2. /evidence=ECO:0000250|UniProtKB:P27812 47..52
CLECT_NK_receptors_like 130..239 CDD:153063 25/136 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345306
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.