DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Clec9a

DIOPT Version :10

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001102824.1 Gene:Clec9a / 502901 RGDID:1562513 Length:241 Species:Rattus norvegicus


Alignment Length:143 Identity:37/143 - (25%)
Similarity:56/143 - (39%) Gaps:24/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CPPKFHRVGTDCYSLVDQRSSWLEAHFFC-KDKNANLTEPGKHADRKLRLFLQKQDALSGENDPI 126
            |||.:.:.|..||...|:..:|..:...| |:.::.|....|.....:.|.:.|   |.|..: .
  Rat   113 CPPNWIQNGKSCYYAFDRWETWNNSKKSCLKEGDSLLQIDSKEEMEFINLSIWK---LKGGYE-Y 173

  Fly   127 WLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQ---PLDNNCAIYDPSLKYRWSAR 188
            |:|...|..:..|.|......||  ....||    :.:|.||   .|.::..|.|          
  Rat   174 WVGVFQDGPSGSWFWEDGSSPLS--DLLPTD----RQLSASQICGYLKDHTLISD---------- 222

  Fly   189 PCSDKLRFICQHK 201
            .||:...|||:.|
  Rat   223 NCSNWKYFICEKK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 32/129 (25%)
Smc <405..>673 CDD:440809
CCDC47 <732..783 CDD:480722
Clec9aNP_001102824.1 ITAM-like 5..10
CLECT_NK_receptors_like 113..234 CDD:153063 36/140 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.