DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and RGD1564770

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001181914.1 Gene:RGD1564770 / 500335 RGDID:1564770 Length:185 Species:Rattus norvegicus


Alignment Length:159 Identity:26/159 - (16%)
Similarity:52/159 - (32%) Gaps:44/159 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TSRPKRRVYA----LCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLF 112
            |.:.|..|.:    :|...::::..:|::.....:||..|...||..:|.|.......:  |.:.
  Rat    52 TRQTKNEVCSDGVKICLHGWNKLNRNCFTHFSHANSWFTAKETCKFHDATLAVFNDQTE--LDIV 114

  Fly   113 LQKQDALSGENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDN----- 172
            :::.:.:    ...|:|.........|.|                       :|....:|     
  Rat   115 MKQMEDI----QTFWIGLYKKDFRGPWVW-----------------------TNGSKYNNWYEVQ 152

  Fly   173 ---NCAIYDPSLKYRWSARPCSDKLRFIC 198
               :||...   |....:..|:|...:||
  Rat   153 DYGHCAFLH---KSGIDSTNCNDLKEYIC 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 22/133 (17%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
RGD1564770NP_001181914.1 CLECT_NK_receptors_like 67..180 CDD:153063 23/144 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.