DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rgn and OLR1

DIOPT Version :9

Sequence 1:	NP_001246866.1	Gene:	rgn / 40368	FlyBaseID:	FBgn0261258	Length:	808	Species:	Drosophila melanogaster
Sequence 2:	NP_002534.1	Gene:	OLR1 / 4973	HGNCID:	8133	Length:	273	Species:	Homo sapiens

Alignment Length:	141	Identity:	37/141 - (26%)
Similarity:	54/141 - (38%)	Gaps:	15/141 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    61 ALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDP 125
            |.||..:...|.:||.......:|.::...|...:|.|.:....||..   |:|:  |:|..:.|
Human   142 APCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLD---FIQQ--AISYSSFP 201

  Fly   126 IWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPC 190
            .|:|.:..:.:..|.|. .|..|....| |...|    :|.:.| ...||.......|   |..|
Human   202 FWMGLSRRNPSYPWLWE-DGSPLMPHLF-RVRGA----VSQTYP-SGTCAYIQRGAVY---AENC 256

  Fly   191 SDKLRFICQHK 201
            ......|||.|
Human   257 ILAAFSICQKK 267

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rgn	NP_001246866.1	CLECT	74..200	CDD:153057	31/125 (25%)
		GBP_C	<414..508	CDD:303769
		TPH	421..756	CDD:290579
		coiled coil	483..494	CDD:293879
OLR1	NP_002534.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..22
		Neck	58..150		3/7 (43%)
		SMC_N	<73..>137	CDD:330553
		CLECT_NK_receptors_like	144..266	CDD:153063	34/136 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165151780
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930