DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Ly49i4

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001009495.1 Gene:Ly49i4 / 494204 RGDID:1549758 Length:280 Species:Rattus norvegicus


Alignment Length:174 Identity:36/174 - (20%)
Similarity:61/174 - (35%) Gaps:43/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SRPKRRVY-----ALCPPKFHRVGTD----------CYSLVDQRSSWLEAHFFCKDKNANLTEPG 102
            :|.:.|.|     .|..|: |..|.|          ||........|.|....|::.:.:..   
  Rat   120 NREQNRWYKKTKTVLASPQ-HTGGCDEMHWFCYGIKCYYFTMDIRIWHECKQTCQNYSLSFL--- 180

  Fly   103 KHADRKLRLFLQKQDALSGENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTD---SAYVQLI 164
            |..|:....||  ||.:..:|  .|:|::|::....|.| :.....:.|..:|..   :.|....
  Rat   181 KIDDKDELKFL--QDHIIRDN--YWIGSSYNNKKKEWSW-IDNSPFNLDFVARNSLRKTGYCMYF 240

  Fly   165 SNSQPLDNNCAIYDPSLKYRWSARPCSDKLRFICQHKMPKVSGP 208
            |.:...|::                |..:...||:..|.|:..|
  Rat   241 SMAGLHDDD----------------CGKRYLCICEKGMDKIPAP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 25/128 (20%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Ly49i4NP_001009495.1 Ly49 40..158 CDD:285577 10/38 (26%)
CLECT_NK_receptors_like 145..260 CDD:153063 25/138 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.