DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Ly49s4

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001009487.1 Gene:Ly49s4 / 494195 RGDID:1549723 Length:277 Species:Rattus norvegicus


Alignment Length:142 Identity:32/142 - (22%)
Similarity:50/142 - (35%) Gaps:29/142 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRL-FLQKQDALSGENDPIWLGATYDH 134
            |..||........|.|    ||....|.:......|.|..| ||  ||.:..:|  .|:|::|::
  Rat   149 GIKCYYFTMDIRIWRE----CKQTCQNYSLSFLKIDVKDELKFL--QDHIIRDN--YWIGSSYNN 205

  Fly   135 HNNRWQWSMSGRNLSTDSFSRTD---SAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSDKLRF 196
            ....|.| :.....:.|..:|..   :.|....|.:...|::                |..:...
  Rat   206 KKKEWSW-IDNSPFNLDFVARNSLRKTGYCMYFSMAGLHDDD----------------CGKRYLC 253

  Fly   197 ICQHKMPKVSGP 208
            ||:..|.|:..|
  Rat   254 ICEKGMDKIPAP 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 28/129 (22%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Ly49s4NP_001009487.1 Ly49 38..155 CDD:285577 3/5 (60%)
CLECT_NK_receptors_like 142..257 CDD:153063 29/132 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.