DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and MRC1

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_002429.1 Gene:MRC1 / 4360 HGNCID:7228 Length:1456 Species:Homo sapiens


Alignment Length:156 Identity:35/156 - (22%)
Similarity:62/156 - (39%) Gaps:32/156 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PPK------FHRVGTDCYSLVDQRSSWLEAHFFCKDKN---ANLTEPGKHADRKLRLFLQKQDAL 119
            ||.      |.:.|...|||:.|:..|.||..:||..|   |::.:|..:|...|:        :
Human  1090 PPATIQTDGFVKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSNAFAWLQ--------M 1146

  Fly   120 SGENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYR 184
            ...|:.:|:....:..:|::.|        ||.:.   ..|....::...|.:.|...|  |...
Human  1147 ETSNERVWIALNSNLTDNQYTW--------TDKWR---VRYTNWAADEPKLKSACVYLD--LDGY 1198

  Fly   185 WSARPCSDKLRFICQH--KMPKVSGP 208
            |....|::...|:|:.  ::|....|
Human  1199 WKTAHCNESFYFLCKRSDEIPATEPP 1224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 29/128 (23%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
MRC1NP_002429.1 RICIN 27..142 CDD:214672
RICIN 34..141 CDD:238092
FN2 161..209 CDD:128373
CLECT 234..342 CDD:153057
CLECT 362..487 CDD:214480
CLECT 504..626 CDD:214480
CLECT 659..779 CDD:153057
CLECT 802..923 CDD:214480
CLECT 945..1080 CDD:214480
CLECT 1097..1213 CDD:214480 30/136 (22%)
CLECT 1230..1356 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.