DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Clec2g

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001041540.1 Gene:Clec2g / 362447 RGDID:1563148 Length:207 Species:Rattus norvegicus


Alignment Length:206 Identity:49/206 - (23%)
Similarity:78/206 - (37%) Gaps:51/206 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMWCC----QVFILALFAHTIAVEFHGSAARAEINFEGPSPAHSQDTAAPTSRPKRRVYALCPPK 66
            |::||    .|..:|:.|.::|:....:...:.||                      .||.||..
  Rat    41 KLYCCYGVIMVLSVAVVALSVALSVKMTPQISTIN----------------------TYAACPRN 83

  Fly    67 FHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRL-FLQKQDALSGENDPIWLGA 130
            :..||..|:...:..|:|..:..|||.:.|.|.    ..|.:..| ||.:   ..|..| .|:|.
  Rat    84 WIGVGNKCFYFSEYASNWTFSQTFCKAQEAELA----RFDTEEELNFLSR---YKGSFD-YWIGL 140

  Fly   131 TYDHHNNRWQWSMSGR---NLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSD 192
            ..:...:.|:|:.:.:   :||.....|  .||:..|..|     :..:|...   |||   ||.
  Rat   141 HRESSEHPWKWTDNTQYNYSLSIRGVER--YAYLNDIGIS-----SARVYADK---RWS---CSK 192

  Fly   193 KLRFICQHKMP 203
            ...:..|.|.|
  Rat   193 LNSYSLQCKTP 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 31/129 (24%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Clec2gNP_001041540.1 PHA02867 41..196 CDD:165201 46/197 (23%)
CLECT_NK_receptors_like 80..192 CDD:153063 34/132 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.