DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Clec2d2

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001078871.1 Gene:Clec2d2 / 362445 RGDID:1562831 Length:233 Species:Rattus norvegicus


Alignment Length:163 Identity:37/163 - (22%)
Similarity:59/163 - (36%) Gaps:46/163 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMWCCQVFILALFAHTIAVEFHGSAARAEINFEGPSPAHSQDTAAPTSRPK---RRVYALCPPKF 67
            |:.||...|:.|....:|:....|..:.                     |:   .:.||.||..:
  Rat    73 KLPCCYGVIMVLSVAVVALSVALSVKKT---------------------PQILTVKTYAACPRNW 116

  Fly    68 HRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRL-FLQKQDALSGENDPIWLGAT 131
            ..||..||...:..|:|..:...||.:.|.|.    ..|.:..| ||::....||    .|:|..
  Rat   117 IGVGNKCYYFNETPSNWTFSQTLCKAQEAELA----RFDTEEELNFLKRHKGSSG----YWIGLH 173

  Fly   132 YDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLI 164
            .:..:..|:|        ||     ::||..|:
  Rat   174 RESSSQPWKW--------TD-----NTAYNNLV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 23/92 (25%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Clec2d2NP_001078871.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
CLECT_NK_receptors_like 112..224 CDD:153063 27/103 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.