DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klre1

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_852037.1 Gene:Klre1 / 297645 RGDID:727903 Length:226 Species:Rattus norvegicus


Alignment Length:137 Identity:34/137 - (24%)
Similarity:54/137 - (39%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPIW 127
            ||..:......||....::..|.|:...|...|::|          :|:..::.|..|.::. .|
  Rat   113 CPENWVWFRCSCYYFSKEKLVWRESQRACLSFNSSL----------IRMNKEEMDFFSLKSF-FW 166

  Fly   128 LGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSD 192
            :|..||..:.:|.|         |..|...|.....:.:|.  .|.||.|  ..|..:.|..||.
  Rat   167 VGVYYDETSKQWLW---------DDHSVLPSGMFSGLESSP--KNFCASY--KSKEAYLAENCST 218

  Fly   193 KLRFICQ 199
            ||.:||:
  Rat   219 KLMYICK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 32/126 (25%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Klre1NP_852037.1 CLECT_NK_receptors_like 113..226 CDD:153063 34/137 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_119449
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.