DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and CLEC9A

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_997228.1 Gene:CLEC9A / 283420 HGNCID:26705 Length:241 Species:Homo sapiens


Alignment Length:244 Identity:53/244 - (21%)
Similarity:83/244 - (34%) Gaps:96/244 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CCQVFILA------------------LFAHTIAVEFHG---SAARAEINF--------------- 37
            ||.|.:::                  |...|||::...   ...||.:||               
Human    33 CCLVMVISCVFCMGLLTASIFLGVKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQ 97

  Fly    38 ----EGPSPAHSQDTAAPTSRPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANL 98
                ...|.||:       |.|       ||..:.:....||.:.:..|.|..:...|..:.:.|
Human    98 AFMQNSLSSAHN-------SSP-------CPNNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTL 148

  Fly    99 TEPGKHADRKLRLFLQKQDALSGENDPI------WLGATYDHHNNRWQWSMSGRNLSTDSF--SR 155
            .:    .:.|     ::.|.::|....|      |:|.:.|.|:.||.| ..|.:.|....  .|
Human   149 LQ----IESK-----EEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLW-QDGSSPSPGLLPAER 203

  Fly   156 TDSA-----YVQLISNSQPLDNNCAIYDPSLKYRWSARPCSDKLRFICQ 199
            :.||     ||:  |||. |.:||:.:    ||            |||:
Human   204 SQSANQVCGYVK--SNSL-LSSNCSTW----KY------------FICE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 35/139 (25%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
CLEC9ANP_997228.1 ITAM-like 5..10
CLECT_NK_receptors_like 113..234 CDD:153063 37/150 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151793
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.