DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and SPBC16E9.02c

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_595784.1 Gene:SPBC16E9.02c / 2539809 PomBaseID:SPBC16E9.02c Length:569 Species:Schizosaccharomyces pombe


Alignment Length:581 Identity:115/581 - (19%)
Similarity:205/581 - (35%) Gaps:152/581 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 QPAQQRQRNRPRTSTVAPTTTQSVSQSNDVLAPS--------------PTPQ---QMTQ------ 330
            :|....::.|.......|.|..::.::  |||.|              ..||   :|.|      
pombe    13 RPPYMAEKARATLKEAFPNTDDAIIRA--VLAASGYKLEPAFNALLGLSDPQVAEEMEQAETSYA 75

  Fly   331 -----YDRKLQRQRERERR--RQLRRQERQKLAREQKRERQRRLKEERQRLQREEQQRRQRLHHD 388
                 :|..:|||.|.:.|  |:|..       |......:||.|....|.....|.|       
pombe    76 YDTAAHDDPVQRQLEEDERCARELAN-------RYNSHRPERRRKTNNDRRNYPPQNR------- 126

  Fly   389 EPKPQVN------------PQVKPQVI---DELRQRSGE-------DLDKNQTDEHEQKLRNEQE 431
            ..||..|            |.:|...:   ...:|||.|       ..|..:.|:.::|.  ...
pombe   127 TAKPNDNDGDDYSFFEDDLPVIKDTFMRGFQSFKQRSMEWVENIASKFDGEEEDDDDEKY--SAP 189

  Fly   432 KKLREEQQKQRDEQEQKDREEQ----DRLK------------QEEEQARTHQKE-----LKENQE 475
            .|:....::......:...||:    .|.|            .|.:....::|:     |:.:..
pombe   190 SKIYPSPRRSTAATLESAYEERPPSLPRRKPSRPGTAITLPPYESDPHMLNEKDFERLRLESSSS 254

  Fly   476 QQLRELKAKQEREKQERDYQQQKREHELELLKQRQA-----------EADRQHAADEEAEKLRLE 529
            ..:|.......|...|........|.:..:|....|           ::|.:.|.:||.| ::.:
pombe   255 PMMRRSSLNSNRRSVESSSSAAFVEGQSFILDSNGAIEVANSAFALDDSDLESAYNEELE-MKKD 318

  Fly   530 RIQ-----KQRELEAQQRREREEQRRKQREEQEEQDRQNHAKR---LAEEKRLHDLYAERIRLAN 586
            ..:     |:..:|.:....|::..|......|||...::||.   .:|.|....:.||:     
pombe   319 TSKPTASTKEVVVEKKPDESRKQAARTLETVSEEQMGSSNAKSKVLTSEPKDSTSVEAEK----- 378

  Fly   587 TEREK--------------QLAEAHEAKRLEELKLQEQLKKQEDERQEQIRREQEEEEKRLELER 637
            ||.::              :::|..|||..:.   :..|:::.|..:|   :|.::|..:..|. 
pombe   379 TETDEPAVGKGASDVSDTAEISEKTEAKNADS---EANLEEKSDVGEE---KESKDENNKASLH- 436

  Fly   638 LEEARRFEEKELKRLHEENQRRE-EQKLQREREIALREAAEKKLAEEEEMLRKEVAEEERKVKQR 701
                :..|||:.|..:|:..:.| :.|.:....|...:..||..::|.|...:|...:|..||.:
pombe   437 ----KDVEEKDTKITNEDTGKTETDVKAKETDSIEANDKDEKTDSKETEDKVEETESKEADVKAK 497

  Fly   702 LED--EMRQAEEARKAKEAEERAA--------EEAKAAEQKRRVEAAKKKADEEVKAKLEE 752
            ..|  |:...||...:||..::..        |:....:.|...|.|:|...::||.|:||
pombe   498 ETDSIEVDDKEEKTDSKETADKVEQTDSKDTNEKPAKDDNKEANEKAEKVDSKDVKEKIEE 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057
GBP_C <414..508 CDD:303769 16/114 (14%)
TPH 421..756 CDD:290579 77/397 (19%)
coiled coil 483..494 CDD:293879 2/10 (20%)
SPBC16E9.02cNP_595784.1 CUE_Cue5p_like 17..61 CDD:270555 7/45 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.