DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klra22

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_775413.2 Gene:Klra22 / 24933 RGDID:3023 Length:265 Species:Rattus norvegicus


Alignment Length:113 Identity:28/113 - (24%)
Similarity:45/113 - (39%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGEN-----DPIWLGA 130
            |..||..:..|.:|......|::.:..|            |.:..:|.|...:     |..|:|.
  Rat   150 GIKCYYFIMDRKTWSGCTQTCQNFSLPL------------LTIDDEDELMFLHLLVTPDSYWIGL 202

  Fly   131 TYDHHNNRWQW---SMSGRNLSTDSFSRTDSAYVQLISNSQPLDN-NC 174
            :||:..:.|.|   :.|...|:|..::..|...|.|  :...||| ||
  Rat   203 SYDNKKSDWTWIDNNPSKLALNTRKYNIKDGGCVFL--SKTRLDNINC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 27/110 (25%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Klra22NP_775413.2 Ly49 38..156 CDD:400616 3/5 (60%)
CLECT_NK_receptors_like 143..258 CDD:153063 28/113 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.