DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klrh1

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001014997.1 Gene:Klrh1 / 232415 MGIID:2685002 Length:223 Species:Mus musculus


Alignment Length:212 Identity:44/212 - (20%)
Similarity:71/212 - (33%) Gaps:48/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WCCQVFILA------LFAHTI-AVEFHGSAARAEINFE---------GPSPAHSQD---TAAPTS 53
            |...|.||.      |.:.|: ...|..:.:..:|.:|         .....||..   |||   
Mouse    32 WRISVVILGTVCLCLLISSTVFGYWFFQATSNFKIQYEKDKNESAVSSMEVVHSSGLLLTAA--- 93

  Fly    54 RPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDA 118
               |:....|...:...|..||...::..:|.|:...||...:.|   .|...|:.:.|:|.|  
Mouse    94 ---RKGCYTCQGGWSCCGGKCYFFSEEEKTWDESEASCKVLGSLL---AKIDSREEQNFIQSQ-- 150

  Fly   119 LSGENDPIWLGATYDHHNNRWQW-SMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLK 182
               .|...|:|  .....:::|| ......||:|         :...:.:...|..|....|.  
Mouse   151 ---VNYSYWVG--LHKKGSQFQWVHHKDAKLSSD---------LDFHTATHVADAECGYIKPK-- 199

  Fly   183 YRWSARPCSDKLRFICQ 199
             ..:..||.....:||:
Mouse   200 -NLNVAPCHRYFYYICK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 27/127 (21%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Klrh1NP_001014997.1 Ly49 31..114 CDD:285577 19/87 (22%)
CLECT_NK_receptors_like 100..216 CDD:153063 29/138 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.