DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Clec9a

DIOPT Version :10

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001192292.1 Gene:Clec9a / 232414 MGIID:2444608 Length:264 Species:Mus musculus


Alignment Length:166 Identity:36/166 - (21%)
Similarity:58/166 - (34%) Gaps:33/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PSPAHSQDTAAPTSRPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKH 104
            |....|::|.:..|.        ||..:.:.|..||.:.::...|..:...|..:.|:|.:    
Mouse   122 PQTLDSKETGSDCSP--------CPHNWIQNGKSCYYVFERWEMWNISKKSCLKEGASLFQ---- 174

  Fly   105 ADRKLRL-FLQKQDALSGENDPIWLGATYDHHNNRWQWSMSGRNLS---TDSFSRTDSAYVQLIS 165
            .|.|..: |:.....|.|.| ..|:|...|..:..|.|......||   .....|:.......:.
Mouse   175 IDSKEEMEFISSIGKLKGGN-KYWVGVFQDGISGSWFWEDGSSPLSDLLPAERQRSAGQICGYLK 238

  Fly   166 NSQPLDNNCAIYDPSLKYRWSARPCSDKLRFICQHK 201
            :|..:.:.|    .|.||            |||:.|
Mouse   239 DSTLISDKC----DSWKY------------FICEKK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 28/129 (22%)
Smc <405..>673 CDD:440809
CCDC47 <732..783 CDD:480722
Clec9aNP_001192292.1 CLECT_NK_receptors_like 137..257 CDD:153063 31/140 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.