DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Clec2e

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_705726.3 Gene:Clec2e / 232409 MGIID:3028921 Length:216 Species:Mus musculus


Alignment Length:223 Identity:41/223 - (18%)
Similarity:70/223 - (31%) Gaps:78/223 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KMWCCQVFILALFAHTIAVEFHGSAARAEINFEGPSPAHSQDTAAPTSRPKRRVYALCPPKFHRV 70
            |::||...|:.|....:|:....|..:.:...|...|.                ||:|...:...
Mouse    48 KLYCCYGVIMVLTVAVVALSVTLSVRKKKPVMESCEPC----------------YAVCSSGWIGF 96

  Fly    71 GTDCYSLVDQRSSW---------LEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPI 126
            |..|:...:...:|         |:||....|....|.            ||::....|..    
Mouse    97 GNKCFYFSEDMGNWTFSQSSCIALDAHLALFDSLEELN------------FLKRYKGASDH---- 145

  Fly   127 WLGATYDHHNNRWQWSMSGRNLSTDSFSRT----DSAYVQLISNSQPLDNNCAIYDPS--LKYRW 185
            |:|...:...:.|.|:   .|...::...|    :.||:          :|..||:.|  :..:|
Mouse   146 WIGLHRESSEHPWIWT---DNTEYNNLVLTRGGGECAYL----------SNRGIYNSSGDIHKKW 197

  Fly   186 SARPCSDKLRFICQHKMPKVSGPNRYKI 213
                       ||       :.||.|.:
Mouse   198 -----------IC-------NKPNNYTL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 25/140 (18%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Clec2eNP_705726.3 PHA03097 42..199 CDD:222982 36/206 (17%)
CLECT_NK_receptors_like 89..201 CDD:153063 27/158 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.