Sequence 1: | NP_001246866.1 | Gene: | rgn / 40368 | FlyBaseID: | FBgn0261258 | Length: | 808 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_694734.1 | Gene: | Klrb1f / 232408 | MGIID: | 2442965 | Length: | 217 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 39/201 - (19%) |
---|---|---|---|
Similarity: | 65/201 - (32%) | Gaps: | 52/201 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 VFILALFAHTIAVEFHGSAARAEINFEGPSPAHSQDTAAPTSRPK---RRVYALCPPKFHRVGTD 73
Fly 74 CYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQK-------QDALSGENDPIWLGAT 131
Fly 132 YDHHNNRWQW---SMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCSDK 193
Fly 194 LRFICQ 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rgn | NP_001246866.1 | CLECT | 74..200 | CDD:153057 | 27/136 (20%) |
GBP_C | <414..508 | CDD:303769 | |||
TPH | 421..756 | CDD:290579 | |||
coiled coil | 483..494 | CDD:293879 | |||
Klrb1f | NP_694734.1 | LCK-binding motif. /evidence=ECO:0000255 | 31..34 | ||
CLECT_NK_receptors_like | 94..212 | CDD:153063 | 30/147 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167841915 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |