DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment rgn and FCER2

DIOPT Version :9

Sequence 1:	NP_001246866.1	Gene:	rgn / 40368	FlyBaseID:	FBgn0261258	Length:	808	Species:	Drosophila melanogaster
Sequence 2:	NP_001207429.1	Gene:	FCER2 / 2208	HGNCID:	3612	Length:	321	Species:	Homo sapiens

Alignment Length:	100	Identity:	28/100 - (28%)
Similarity:	45/100 - (45%)	Gaps:	27/100 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   456 LKQEEEQARTHQKELKENQE-----------------QQLRELKAKQEREKQ---ERDYQQQKRE 500
            |||.||:|..:..::.:|.|                 |:|.||:|:|:|.|.   |..:.....:
Human    53 LKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQ 117

  Fly   501 HELELLKQRQAEADRQHAAD------EEAEKLRLE 529
            .:|...|.::.. :|..|:|      ||..|||:|
Human   118 ADLSSFKSQELN-ERNEASDLLERLREEVTKLRME 151

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
rgn	NP_001246866.1	CLECT	74..200	CDD:153057
		GBP_C	<414..508	CDD:303769	18/71 (25%)
		TPH	421..756	CDD:290579	27/99 (27%)
		coiled coil	483..494	CDD:293879	5/13 (38%)
FCER2	NP_001207429.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	66..85		2/18 (11%)
		Repetitive region	69..89		2/19 (11%)
		RILP-like	<77..153	CDD:304877	19/75 (25%)
		Repetitive region	90..110		9/19 (47%)
		Repetitive region	111..131		2/20 (10%)
		CLECT	163..282	CDD:214480
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	290..321
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000