DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and clec-146

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001254401.1 Gene:clec-146 / 175004 WormBaseID:WBGene00013008 Length:189 Species:Caenorhabditis elegans


Alignment Length:203 Identity:44/203 - (21%)
Similarity:72/203 - (35%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VFILALFAHTIAVEFHGSAARAEI-----------NFEGPSPAHSQDTAAPTSRPKRRVYALCPP 65
            :|.:.|.|..:..:|:....|:..           ||||.:....:......:|.::.:..|...
 Worm     4 IFSVLLLAAVVQTQFNFHGMRSFFSTDEEFPTQLQNFEGRTETEIRTLKEKVARLEKLIDGLQSV 68

  Fly    66 KFHRVGT----DCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPI 126
            ......|    ..|.|.::|.||..|...|:...|:|......|...   |:......|..:|..
 Worm    69 LMKEWNTTESGSKYRLFEERKSWDNAERHCQGFGAHLAIIDNEAKNG---FVTNLINSSETSDFA 130

  Fly   127 WLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCS 191
            |:|                  :.|.:.::|.:.:....|.| |:| .||:.|  .|..||.|.|.
 Worm   131 WIG------------------MKTKTTTQTSTPFTNFDSES-PID-GCAVMD--AKGVWSIRSCI 173

  Fly   192 DKLRFICQ 199
            ....|:||
 Worm   174 QLRPFVCQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 32/126 (25%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
clec-146NP_001254401.1 CLECT 78..181 CDD:214480 30/127 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.