Sequence 1: | NP_001246866.1 | Gene: | rgn / 40368 | FlyBaseID: | FBgn0261258 | Length: | 808 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254401.1 | Gene: | clec-146 / 175004 | WormBaseID: | WBGene00013008 | Length: | 189 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 44/203 - (21%) |
---|---|---|---|
Similarity: | 72/203 - (35%) | Gaps: | 40/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 VFILALFAHTIAVEFHGSAARAEI-----------NFEGPSPAHSQDTAAPTSRPKRRVYALCPP 65
Fly 66 KFHRVGT----DCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPI 126
Fly 127 WLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQLISNSQPLDNNCAIYDPSLKYRWSARPCS 191
Fly 192 DKLRFICQ 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rgn | NP_001246866.1 | CLECT | 74..200 | CDD:153057 | 32/126 (25%) |
GBP_C | <414..508 | CDD:303769 | |||
TPH | 421..756 | CDD:290579 | |||
coiled coil | 483..494 | CDD:293879 | |||
clec-146 | NP_001254401.1 | CLECT | 78..181 | CDD:214480 | 30/127 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160161753 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |