DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klra17

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001368891.1 Gene:Klra17 / 170733 MGIID:2180674 Length:274 Species:Mus musculus


Alignment Length:147 Identity:33/147 - (22%)
Similarity:59/147 - (40%) Gaps:35/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGENDPIWLGATYDHH 135
            |..||..:..:..|.:....|:..:.:|.:.....:.|   |||    |....|..|:|.::|..
Mouse   153 GIKCYYFIMNKKGWRKCKQICEHYSLSLLKIDAEDELK---FLQ----LQVTPDSYWIGFSFDKK 210

  Fly   136 NNRWQWSMSGR-----NLSTDSFSRTDSAYVQLISNSQPLDNNCA-IYDPSLKYRWSARPCSDKL 194
            :.:|.|..:|.     |:||.:....:..:   :|.::..:|.|. :|           ||    
Mouse   211 SEKWTWIENGTSKYALNMSTYNVKSGECVF---LSKTRLENNKCEHVY-----------PC---- 257

  Fly   195 RFICQHKMPKV--SGPN 209
              ||:.::.|.  |.||
Mouse   258 --ICEKRLDKFPDSLPN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 28/131 (21%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Klra17NP_001368891.1 Ly49 41..159 CDD:400616 3/5 (60%)
CLECT_NK_receptors_like 146..261 CDD:153063 29/134 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.