DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klra3

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_001276533.1 Gene:Klra3 / 16634 MGIID:101905 Length:266 Species:Mus musculus


Alignment Length:99 Identity:24/99 - (24%)
Similarity:39/99 - (39%) Gaps:15/99 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DTAAPTSRPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRL 111
            |::..|.|..:  |..|      ..|.||..:..:::|......|:..:..:.   |..|.....
Mouse   135 DSSRDTGRGVK--YWFC------YSTKCYYFIMNKTTWSGCKANCQHYSVPIL---KIEDEDELK 188

  Fly   112 FLQKQDALSGENDPIWLGATYDHHNNRWQWSMSG 145
            |||:.  :..||  .|:|.:||.....|.|..:|
Mouse   189 FLQRH--VIPEN--YWIGLSYDKKKKEWAWIDNG 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 18/72 (25%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Klra3NP_001276533.1 Ly49 40..157 CDD:285577 8/29 (28%)
CLECT_NK_receptors_like 145..259 CDD:153063 21/89 (24%)
Involved in dimerization 147..151 1/9 (11%)
Implicated in MHC class I binding 160..162 0/1 (0%)