DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klra1

DIOPT Version :10

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:NP_057868.2 Gene:Klra1 / 16627 MGIID:101907 Length:262 Species:Mus musculus


Alignment Length:121 Identity:34/121 - (28%)
Similarity:51/121 - (42%) Gaps:19/121 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHADRKLRLFLQKQDALSGE 122
            :||..|      .|..||..|..|.:|......|:..:.:|.:.....:.|   |||    |...
Mouse   140 KVYWFC------YGMKCYYFVMDRKTWSGCKQTCQSSSLSLLKIDDEDELK---FLQ----LVVP 191

  Fly   123 NDPIWLGATYDHHNNRWQW---SMSGRNLSTDSFSRTDSAYVQLISNSQPLDN-NC 174
            :|..|:|.:||:....|.|   ..|...|:|..::..|.. ..|:|.:: ||| ||
Mouse   192 SDSCWVGLSYDNKKKDWAWIDNRPSKLALNTRKYNIRDGG-CMLLSKTR-LDNGNC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 30/105 (29%)
Smc <405..>673 CDD:440809
CCDC47 <732..783 CDD:480722
Klra1NP_057868.2 Ly49 40..153 CDD:462461 6/18 (33%)
Cell attachment site 137..139
CLECT_NK_receptors_like 142..255 CDD:153063 33/119 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.