DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rgn and Klrb1

DIOPT Version :9

Sequence 1:NP_001246866.1 Gene:rgn / 40368 FlyBaseID:FBgn0261258 Length:808 Species:Drosophila melanogaster
Sequence 2:XP_017176770.1 Gene:Klrb1 / 100043861 MGIID:96877 Length:243 Species:Mus musculus


Alignment Length:172 Identity:37/172 - (21%)
Similarity:63/172 - (36%) Gaps:36/172 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SPAHSQDTAAPTSRPKRRVYALCPPKFHRVGTDCYSLVDQRSSWLEAHFFCKDKNANLTEPGKHA 105
            |.|..::...||.   |.....||..:|.....|.........|.:....|..|.|.|       
Mouse   101 SVAVQENRTEPTG---RSATLECPRDWHPHCDKCLFTSQTSRPWADGLVDCNLKGATL------- 155

  Fly   106 DRKLRLFLQKQDAL-------SGENDPIWLGATYDHHNNRWQWSMSGRNLSTDSFSRTDSAYVQL 163
                 |.:|.::.|       .|:....::|..|:..:..|:| |:|..|:|:        .:|:
Mouse   156 -----LLIQDEEELRLLQNFSKGKGQQFYIGLKYEEVDKVWKW-MNGSILNTN--------LLQI 206

  Fly   164 ISNSQPLDNNCAIYDPSLKYRWSARPCSDKLRFICQHKMPKV 205
            ....:  :|:||:...:..:..|   ||....:|||..:..|
Mouse   207 TGKDE--ENSCALISQTEVFSDS---CSSDNHWICQKTLKHV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rgnNP_001246866.1 CLECT 74..200 CDD:153057 27/132 (20%)
GBP_C <414..508 CDD:303769
TPH 421..756 CDD:290579
coiled coil 483..494 CDD:293879
Klrb1XP_017176770.1 CLECT_NK_receptors_like 120..238 CDD:153063 30/143 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.