DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and AT1G31240

DIOPT Version :9

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_174409.1 Gene:AT1G31240 / 840012 AraportID:AT1G31240 Length:277 Species:Arabidopsis thaliana


Alignment Length:156 Identity:33/156 - (21%)
Similarity:61/156 - (39%) Gaps:42/156 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LDNLLASKNCEVV----DDVLRQSMLELLRGKF-REIARQTTNWSNHAGRCAPSYFDLERTFIRM 71
            |..:..|:.|:.:    .|....:.|.|...|| :.:|...:::||.|.|...:.||:......:
plant    30 LTKIAVSQICQSIGYKATDASALNTLTLTTTKFLQSLAELASSFSNTANRTEVNLFDIVNGLQDI 94

  Fly    72 NIKVGEL----KAMYEGQPDSLV--LVECN-------APE----------TQDQDF-----HSVP 108
            .:...:.    ..:::.:...|:  .|..|       |||          .:|..|     |   
plant    95 ALSTSDCFPGGSTVHDIESQCLIKSAVLRNLSDFVTYAPEIPFAKPLPRRERDGSFGGDLDH--- 156

  Fly   109 QPVLSSTKAVELASTTYIPDHLPPFP 134
               ::.|::|::.|   :|..|||||
plant   157 ---VAVTRSVDVTS---VPAWLPPFP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 15/69 (22%)
TAF8 125..177 CDD:176263 6/10 (60%)
AT1G31240NP_174409.1 BTP 25..100 CDD:128846 15/69 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.