DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and AT5G15570

DIOPT Version :9

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_197061.1 Gene:AT5G15570 / 831410 AraportID:AT5G15570 Length:381 Species:Arabidopsis thaliana


Alignment Length:360 Identity:70/360 - (19%)
Similarity:123/360 - (34%) Gaps:122/360 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ATVLDNLLASKNCEVVD----DVLRQSMLELLRGKFREIARQTTN----------------WSNH 53
            |..|..:..::.||.|:    ....||...|....|:|.|.:|..                :.|.
plant    28 AYALARMATAQICESVEINSYQESSQSREGLRFSSFQETALETLTDVVIQYIQNIGKTAQFYVNM 92

  Fly    54 AGRCAPSYFDLERTFIRMNIKVGELKAMYEGQPDSLVLVECNAP------------ETQDQDF-H 105
            |||...:..|:.:....:...:|     ::|..|   :..|.|.            |.::..| :
plant    93 AGRVESNALDIVQALEDLGSGLG-----FDGAHD---VEHCLADSGVVKDIIRYTGEAEEIPFVY 149

  Fly   106 SVP--------QPVLSSTKAVELASTTYIPDHLPPFP------GAHTYKSSTIEK-VTDR----S 151
            |:|        :|..|.:.........:||..||.||      |:.......||: |..|    |
plant   150 SLPRFPFNRGKRPAPSFSDIGVEPPDEHIPVWLPAFPETKMSNGSEEINVDKIERDVQSRDNGSS 214

  Fly   152 YVAMRNRHAENELNTQNALNQYYLR-------CNP-----------NISLF-----EETQRD--G 191
            .::::.....:.|..|.:::|..::       .||           |:||.     .|.:::  .
plant   215 LMSVQQSVDVDRLKVQKSMDQKDVQKPIEEPEGNPFLAAPIWVGEKNVSLSRVVCPSELRKEEIS 279

  Fly   192 SGHVLDLGPPKK-------LPYSDALMPRNQVFDTDIYAPIE------------------VITHK 231
            :.|:     |:|       :|..:|....:::.|.:..|.:|                  :.|.|
plant   280 TNHL-----PEKHMSMSHHIPALEAYALSDKINDKNRLAGMEDEQKRDGARTQGALLRFKIGTRK 339

  Fly   232 ALDC----RYLEKPKLHSSRPSSGNFEEEDVEMEE 262
            |.:|    :.||:.....   ..||..|:.||.||
plant   340 ASECWKINQCLEEKGWFK---EDGNKREKKVEREE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 17/87 (20%)
TAF8 125..177 CDD:176263 15/69 (22%)
AT5G15570NP_197061.1 BTP 25..116 CDD:128846 18/92 (20%)
TAF8 176..221 CDD:299470 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.