DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and TAF8

DIOPT Version :9

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_567964.1 Gene:TAF8 / 829584 AraportID:AT4G34340 Length:353 Species:Arabidopsis thaliana


Alignment Length:298 Identity:61/298 - (20%)
Similarity:106/298 - (35%) Gaps:80/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CEVVD-DVLRQSMLELLRG----KFREIARQTTNWSNHAGRCAPSYFDL---------------- 64
            ||.|. :..:...||.|.|    ...::.:..|:::|..||...:.||:                
plant    39 CESVGYENFKDPALESLSGFALQYILQLGKTATSFANLTGRSQCNVFDIILALDDLTDNNGEQGI 103

  Fly    65 --ERTFIRMNIKVGELKAMYEGQPDSLVLVECNAPETQDQDFHSVPQPVLSSTKA-----VELAS 122
              |...:..:||:.|:          :..|..:......|...|.|..:...::.     ||:..
plant   104 SSESCSLGRSIKLREI----------IDFVNSSEEVPFSQPLPSFPVAISDRSRKMIPSFVEIGE 158

  Fly   123 T---TYIPDHLPPFPGAHTYKSST--IEKVT----DRSYVAMRNRHAENELNTQNALNQYYLRC- 177
            |   .:||..||.||..||||.:.  ||:|:    |:...|.:.|.||..|.:.    |..|.| 
plant   159 TPPGKHIPLWLPAFPDPHTYKETPMWIERVSDPRGDKIEQARQRRKAERALLSL----QRKLVCK 219

  Fly   178 ----NP---NISLFEETQRDGSGHVLDLGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDC 235
                ||   ::...:|..||....:..:...:|:          :..:.|..:.||...      
plant   220 ISSRNPVWGDMDGVKEEMRDDESELRSVSSGEKV----------ESLNRDGLSVIEAFA------ 268

  Fly   236 RYLEKPKLHSSRPSSGNFEEEDVEMEEPCSPGGLGIEK 273
                 |.:.::|....:....:.:..:|.:...|..||
plant   269 -----PAMEAARDGFSSEAHTEWKKNKPVALSKLRTEK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 16/78 (21%)
TAF8 125..177 CDD:176263 21/57 (37%)
TAF8NP_567964.1 Bromo_TP 24..100 CDD:284856 13/60 (22%)
TAF8 164..216 CDD:176263 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104008
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.