DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and taf3

DIOPT Version :9

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001036209.1 Gene:taf3 / 334474 ZFINID:ZDB-GENE-030131-6406 Length:898 Species:Danio rerio


Alignment Length:268 Identity:50/268 - (18%)
Similarity:90/268 - (33%) Gaps:99/268 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 CEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLERTFIRMNIKVGELKAMYEGQ 85
            |:::.|||.:.:        :::|:....:|...||..|...|:::.|..:.:.:.||:      
Zfish    31 CDLLSDVLERYV--------QQLAKSCHRYSELYGRTDPGLSDVDQAFGFLGVSIAELE------ 81

  Fly    86 PDSLVLVE-CNAPETQDQDFHSVPQPVLSSTKAVELAST---------------TYIPDHLPPFP 134
             |.:..|| ...|:|       :||..:|.:..::..:.               .|||::.||..
Zfish    82 -DYVNNVEPIGYPQT-------IPQFPISKSSVLQFPAAGFDTDARDALRGERRDYIPEYFPPLV 138

  Fly   135 GAHTYKSSTIEKVTD--RSYVAMR-----NRHAENELNTQNALNQYYLRCNPNISLFEETQRDGS 192
            .....:........|  .|..||:     ....|.|.|.:|.|:::                ||.
Zfish   139 SLQEDEEEEEPVPADMGTSAEAMQVSMGEEEDGEEEENDENWLSRH----------------DGQ 187

  Fly   193 GHVLDLGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDCRYLEKPKLHSSRPSSGNFEEED 257
            .           |..:.|:|.                        .::|:| |::|  |...|..
Zfish   188 S-----------PRPEGLLPA------------------------AKRPRL-STKP--GVSPEWS 214

  Fly   258 VEMEEPCS 265
            .|..||.|
Zfish   215 YEPREPLS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 11/55 (20%)
TAF8 125..177 CDD:176263 14/58 (24%)
taf3NP_001036209.1 BTP 5..79 CDD:128846 11/55 (20%)
PHD_TAF3 836..881 CDD:276997
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.