DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and Taf8

DIOPT Version :9

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_523397.1 Gene:Taf8 / 32792 FlyBaseID:FBgn0022724 Length:328 Species:Drosophila melanogaster


Alignment Length:268 Identity:63/268 - (23%)
Similarity:107/268 - (39%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTYDEVLATVLDNLLASKNCEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLE 65
            ::.|..:|..|:..||..|......:...:::.::|:....||.....|:...:||..|:..|:.
  Fly    12 VDPYRRILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVS 76

  Fly    66 RTFIRMNIKVGELKAMYEGQPDSLVLVECNAP------ETQDQDFHSVPQPVLSSTKAVELASTT 124
            ...|.|.|.:..|        |..:..|.:.|      :||.:     |..:|.:  .::.....
  Fly    77 LALINMGISISNL--------DPYMRKETHVPIPLPPQQTQQR-----PLSLLQA--GIKAPHPH 126

  Fly   125 YIPDHLPPFPGAHTYKSSTIEKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLFEETQR 189
            |:|.:.||.|..|.|..:...|.....|.|:|.:.|..:.:.:.||.::..:.....:||   ..
  Fly   127 YVPSYFPPMPDPHAYIRTPTHKQPVTEYEAIREKAACQKRDIEKALTKFLCKTTETNNLF---PT 188

  Fly   190 DGSGHVLDLGPPKKLPYSDALMPRNQVFDTDIYAPIEVITHKALDCRYLEKPKLHSSRPSSGNFE 254
            :.:...|....|...||:.||.|.:||||           .:.|:..||...:. ...||..:.|
  Fly   189 EDNMFPLIACKPAFPPYAAALNPTDQVFD-----------FEELEYHYLVANRT-EDEPSKDDGE 241

  Fly   255 EEDVEMEE 262
            |.|.|.||
  Fly   242 EGDSENEE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 16/70 (23%)
TAF8 125..177 CDD:176263 14/51 (27%)
Taf8NP_523397.1 BTP 15..88 CDD:128846 17/72 (24%)
TAF8 126..179 CDD:176263 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435325
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104008
Panther 1 1.100 - - P PTHR46469
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.