DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and Taf8

DIOPT Version :9

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_008765082.1 Gene:Taf8 / 316216 RGDID:1308423 Length:334 Species:Rattus norvegicus


Alignment Length:300 Identity:75/300 - (25%)
Similarity:116/300 - (38%) Gaps:47/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LATVLDNLLASKNCEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLERTFIRMN 72
            |..|:.:||.....|..:....:::.|:|:....||.|...::..|..|..|:..|:..|.:.|.
  Rat    35 LQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMG 99

  Fly    73 IKVGELKAMYEGQPDSLVLVECNAPETQDQDFHSVPQPVLSSTKAVELASTTYIPDHLPPFPGAH 137
            ..|..|.| |..:...:|:   .||...:|     |....:.|.........:||.|.|.||..|
  Rat   100 FNVDT
LPA-YAKRSQRMVI---TAPPVTNQ-----PVTPKALTAGQNRPHPPHIPSHFPEFPDPH 155

  Fly   138 TY-KSSTI-EKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLFEETQRDGSGHVLDLGP 200
            || |:.|. |.|:|  |..:|.:.|....:.:.||.::..:.....|||::   |.|...|....
  Rat   156 TYIKTPTYREPVSD--YQVLREKAASQRRDVERALTRFMAKTGETQSLFKD---DVSTFPLIAAR 215

  Fly   201 PKKLPYSDALMP---------------RNQVFDTDIYA---------------PIEVITHKALDC 235
            |..:||..||:|               :::..||:..|               |...|:...|:.
  Rat   216 PFTIPYLTALLPSELEIQQMEETDSSEQDEQTDTENIALHISTVGSPLPATLRPCPGISACLLEA 280

  Fly   236 RYLE-KPKLHSSRPSSGNFEEEDVEMEEPCSPGGLGIEKP 274
            |.:. ...||..|...|.....:||...|....|.|.|:|
  Rat   281 RMVGCVTSLHLERHILGVTHSANVERALPGPDPGPGAEEP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 17/68 (25%)
TAF8 125..177 CDD:176263 19/53 (36%)
Taf8XP_008765082.1 Bromo_TP 27..104 CDD:284856 17/68 (25%)
TAF8 142..195 CDD:176263 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104008
Panther 1 1.100 - - O PTHR46469
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.