DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and taf8

DIOPT Version :9

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_588062.1 Gene:taf8 / 2539131 PomBaseID:SPCC1259.06 Length:222 Species:Schizosaccharomyces pombe


Alignment Length:210 Identity:51/210 - (24%)
Similarity:82/210 - (39%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DEVLATVLDNLLASKNCEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLERTFI 69
            :.|:|.:|..|......:..:....:::.:.||..|||:|.. |..|.|.   .|:..|:.....
pombe     2 EAVIANILQQLGFDSMTKAAEASFVEAVDKYLRNSFRELALH-TQLSKHT---IPTTKDVALWLN 62

  Fly    70 RMNIKVGELKAMYE-----------GQPDSLVLVECNAPETQDQDFHSVPQPVLSS--------- 114
            .:||.:..|:...|           .:.|.|      |.|:||     :|....||         
pombe    63 LLNIPMSSLQTELEKYLKPLPPAINDELDRL------ANESQD-----IPSKFKSSLDSKMVSQL 116

  Fly   115 --TKAVELASTTYIPDHLPPFPGAHTYKSSTIEKVTD------RSYVAMRNRHAENELNTQNALN 171
              :.||......|:.:||||||.:|||.::.:..|..      |......:|.||:.|.....:|
pombe   117 LGSLAVSQNRPAYVVNHLPPFPASHTYMATPVYPVRPTSPKQIRELATQESRLAEHALRKILNVN 181

  Fly   172 QYYLRCNPNISLFEE 186
            |.....:|..:.||:
pombe   182 QPRSADSPRHASFEK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 17/70 (24%)
TAF8 125..177 CDD:176263 18/57 (32%)
taf8NP_588062.1 TAF8_C 129..177 CDD:287390 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104008
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.