DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sa and TAF8

DIOPT Version :9

Sequence 1:NP_649311.1 Gene:sa / 40367 FlyBaseID:FBgn0002842 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011512598.1 Gene:TAF8 / 129685 HGNCID:17300 Length:338 Species:Homo sapiens


Alignment Length:271 Identity:70/271 - (25%)
Similarity:109/271 - (40%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LATVLDNLLASKNCEVVDDVLRQSMLELLRGKFREIARQTTNWSNHAGRCAPSYFDLERTFIRMN 72
            |..|:.:||.....|..:....:::.|:|:....||.|...::..|..|..|:..|:..|.:.|.
Human    37 LQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMG 101

  Fly    73 IKVGELKAMYEGQPDSLVLVECNAPETQDQDFHSVPQPVLSSTKAVELASTTYIPDHLPPFPGAH 137
            ..|..|.| |..:...:|:   .||...:|     |....:.|.........:||.|.|.||..|
Human   102 FNVDT
LPA-YAKRSQRMVI---TAPPVTNQ-----PVTPKALTAGQNRPHPPHIPSHFPEFPDPH 157

  Fly   138 TY-KSSTI-EKVTDRSYVAMRNRHAENELNTQNALNQYYLRCNPNISLFEETQRDGSGHVLDLGP 200
            || |:.|. |.|:|  |..:|.:.|....:.:.||.::..:.....|||::   |.|...|....
Human   158 TYIKTPTYREPVSD--YQVLREKAASQRRDVERALTRFMAKTGETQSLFKD---DVSTFPLIAAR 217

  Fly   201 PKKLPYSDALMP----RNQVFDTDIYAPIEVITHKALDCRYLEKPKLHSSRPSSGNFEEEDVEME 261
            |..:||..||:|    ..|:.:||.....|...        .|...||.|...|.:..:..|:.:
Human   218 PFTIPYLTALLPSELEMQQMEETDSSEQDEQTD--------TENLALHISMIESRSVTQAGVQWQ 274

  Fly   262 -----EPCSPG 267
                 :|..||
Human   275 DLGSLQPPPPG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
saNP_649311.1 Bromo_TP 6..77 CDD:284856 17/68 (25%)
TAF8 125..177 CDD:176263 19/53 (36%)
TAF8XP_011512598.1 Bromo_TP 29..106 CDD:284856 17/68 (25%)
TAF8 144..197 CDD:176263 19/54 (35%)
GVQW 266..>303 CDD:290611 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140676
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2389
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290064at2759
OrthoFinder 1 1.000 - - FOG0002869
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104008
Panther 1 1.100 - - O PTHR46469
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.