DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ebd2 and F21D5.4

DIOPT Version :9

Sequence 1:NP_001246865.1 Gene:ebd2 / 40363 FlyBaseID:FBgn0037076 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_501504.1 Gene:F21D5.4 / 184768 WormBaseID:WBGene00009009 Length:259 Species:Caenorhabditis elegans


Alignment Length:278 Identity:59/278 - (21%)
Similarity:98/278 - (35%) Gaps:58/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KSRRNERNILTFYEKIAVIRYYDETNISRNSLAKMFHCCATQ----IRRILDKKKDLLQQLATLS 84
            |.|.|    .|...|..|||:.::||          :|.|.:    .|..:.:.:.|..:||..|
 Worm    19 KKRAN----FTLEFKNEVIRFAEQTN----------NCQAQKKYGVARACIQRWRHLKHELAFES 69

  Fly    85 EADASIIIEEMTRKR-----RKFEMSAISFLLHEWVERCIQMQLNISIRNQKLKETAIRMAAVLN 144
            |.       :...||     |..:...:...:.:|:     ...|..|..:.:||.|.:   :..
 Worm    70 EG-------KQGAKRLGGAGRPLKNVELDEKVEDWI-----ASKNGKISGKDIKEYAKK---ING 119

  Fly   145 LPSFRPSYRWLSRFRNKY---KYEADELGYQGENPLNQDLPVEDIIVEFKHALPNFMQRELDNPG 206
            ...|:.|..||.||..::   |..:.    ..:.|...|...:..:.|....|.|      .:..
 Worm   120 NADFKASNGWLQRFMIRHGLIKARSS----SPKTPSTSDGTTDKTLEESLFELIN------SDEW 174

  Fly   207 EAISKAAVMADFVNLSSENSIMSDHPEGDNEVELVTCEPTMMSSPSSTPDAAEGEIPLQAH---G 268
            :.||:..|.....:.::||...|...||:|.   .|.|..:...|:.:....|..|..|..   .
 Worm   175 KNISEGNVSGFLEDFNAENGETSLKVEGNNS---TTTESEVKQKPNESSKLPEINIFQQLEMLIK 236

  Fly   269 DQENPDDQINAGTSTLLN 286
            |....:|.:.. |.|.:|
 Worm   237 DSNGKEDSVEE-TETSVN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ebd2NP_001246865.1 CENP-B_N 27..80 CDD:282122 12/56 (21%)
CENPB 101..166 CDD:197828 13/67 (19%)
F21D5.4NP_501504.1 BrkDBD 21..65 CDD:286662 13/57 (23%)
CENPB 84..143 CDD:197828 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.