DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ebd2 and tigd3

DIOPT Version :9

Sequence 1:NP_001246865.1 Gene:ebd2 / 40363 FlyBaseID:FBgn0037076 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001128294.1 Gene:tigd3 / 100135169 XenbaseID:XB-GENE-6457180 Length:595 Species:Xenopus tropicalis


Alignment Length:168 Identity:41/168 - (24%)
Similarity:76/168 - (45%) Gaps:20/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KSRRNERNILTFYEKIAVIRYYDETNISRNSLAKMFHCCATQIRRILDKKKDLLQQLATLSEADA 88
            |.||:.    |..||:.::....:...|::|:|:......:.|.|::..:::::::...      
 Frog    18 KKRRDS----TLAEKVKILELLQQPKASQSSVARNLGLSQSTISRVMKNREEIMERWNQ------ 72

  Fly    89 SIIIEEMTRKR-RKFEMSAISFLLHEWVERCIQMQLNISIRNQKLKETAIRMAAVLNLPSFRPSY 152
               .|...||| |.|:.:.:...|.||:......:|.||  ...|...|..:|..:..|.|:||.
 Frog    73 ---NENPARKRNRPFKHAKVDEALLEWLLFAKANKLPIS--GPILMRRAEAIAKEIGCPQFKPSN 132

  Fly   153 RWLSRFRNKYK--YEADELGYQGENPL--NQDLPVEDI 186
            .||.|::.:|:  |..:.|..|....:  .||:|..:|
 Frog   133 GWLWRWKERYRLFYRTEVLPCQRSGMILQGQDVPESEI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ebd2NP_001246865.1 CENP-B_N 27..80 CDD:282122 9/52 (17%)
CENPB 101..166 CDD:197828 19/66 (29%)
tigd3NP_001128294.1 HTH 18..68 CDD:304362 11/53 (21%)
CENPB 83..147 CDD:197828 18/65 (28%)
rve 248..421 CDD:304425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.