DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and TEM1

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_013647.1 Gene:TEM1 / 854938 SGDID:S000004529 Length:245 Species:Saccharomyces cerevisiae


Alignment Length:177 Identity:42/177 - (23%)
Similarity:83/177 - (46%) Gaps:12/177 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 SSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRV 262
            :::..|...::.::  :|.::||:.||||||::::....|...| ..|:|::|..:.|.:..|.:
Yeast     8 ANNSIPAVRNQVEV--QVGLVGDAQVGKTSLMVKYVQNIYDKEY-TQTLGVNFLKRKVSIRSTDI 69

  Fly   263 KLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVI-VLIGN 326
            ...|.|..||..|.::.......:..::.|:|:|...|..:|:.|..:  .|...|..| :|:|.
Yeast    70 IFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQ--AYGLNDSAIPILVGT 132

  Fly   327 KADC-----SGSERQVKREDGERLGREHNVPFMETSAKTGLNVELSF 368
            |.|.     ...:.|:.| ...:..:..|.|.:..|....:|::..|
Yeast   133 KYDLLIDLDPEYQEQISR-TSMKYAQVMNAPLIFCSTAKSINIQKIF 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 41/161 (25%)
RAB 214..378 CDD:197555 41/161 (25%)
TEM1NP_013647.1 Spg1 21..202 CDD:206701 41/164 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.