DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and SEC4

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_116650.1 Gene:SEC4 / 850543 SGDID:S000001889 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:83/214 - (38%)
Similarity:141/214 - (65%) Gaps:12/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 IRMISSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVD 258
            :|.:|:|..  ....:|.:.|::::|||||||:.||:||.:.::.|| |::|:||||:.|.|.::
Yeast     4 LRTVSASSG--NGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPS-FITTIGIDFKIKTVDIN 65

  Fly   259 GTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVL 323
            |.:||||:||||||||||::|.||||.|..::|:||||::.|:.||:.|...:.|:|.::..::|
Yeast    66 GKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLL 130

  Fly   324 IGNKADCSGSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR-------GYE 381
            :|||:|.  ..|.|..:.||.|.:|..:||:|:|||...||...|..:|:.::.:       |..
Yeast   131 VGNKSDM--ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVG 193

  Fly   382 HGDDGKFNVHDFVRDNTKA 400
            :|.:|..:::....:::|:
Yeast   194 NGKEGNISINSGSGNSSKS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 79/194 (41%)
RAB 214..378 CDD:197555 75/163 (46%)
SEC4NP_116650.1 Rab8_Rab10_Rab13_like 18..183 CDD:206659 76/167 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.