DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and RABA3

DIOPT Version :10

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_171628.2 Gene:RABA3 / 839493 AraportID:AT1G01200 Length:237 Species:Arabidopsis thaliana


Alignment Length:31 Identity:10/31 - (32%)
Similarity:14/31 - (45%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLGMLIDIVDEEWMRDTLPDDDLPLPPVLAV 35
            |:|.....::|:...|..|...|...|.|||
plant   378 SVGFPSSGINEDSKDDVTPPSYLMEHPPLAV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695
RABA3NP_171628.2 Rab11_like 26..191 CDD:206660
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.