DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and RAB8

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001078278.1 Gene:RAB8 / 824529 AraportID:AT3G53610 Length:216 Species:Arabidopsis thaliana


Alignment Length:171 Identity:85/171 - (49%)
Similarity:128/171 - (74%) Gaps:1/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 EFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQ 272
            ::|.:.|::::|||||||:.||:||.||.:..| |::|:||||:.:.:.:||.|:||||||||||
plant    11 DYDYLIKLLLIGDSGVGKSCLLLRFSDGSFTTS-FITTIGIDFKIRTIELDGKRIKLQIWDTAGQ 74

  Fly   273 ERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQV 337
            ||||::|.||||.|..:||:||||::::::|||.|:..|.::|.:.|..:|:|||||...|:|.|
plant    75 ERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDSVNKILVGNKADMDESKRAV 139

  Fly   338 KREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR 378
            .:..|:.|..|:.:.|.||||||.||||..|.::|:.:|.|
plant   140 PKSKGQALADEYGMKFFETSAKTNLNVEEVFFSIAKDIKQR 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 84/165 (51%)
RAB 214..378 CDD:197555 83/163 (51%)
RAB8NP_001078278.1 Rab8_Rab10_Rab13_like 13..180 CDD:206659 84/167 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.