DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and SGP2

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_850622.1 Gene:SGP2 / 821724 AraportID:AT3G21700 Length:292 Species:Arabidopsis thaliana


Alignment Length:175 Identity:46/175 - (26%)
Similarity:87/175 - (49%) Gaps:18/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 VARPPVAPAP---VAPGPGSEGASATLCKNAGRALIR--MISSSKAPEEEDEFDIMG-KVIMLGD 220
            |:||..:|.|   |..|.|..|         |..:.|  ::..:.......:.|::. |:.:|||
plant    59 VSRPSPSPIPAVDVVVGGGGGG---------GEFVRRSSVVYDNDNSHRRSDSDLVSLKISLLGD 114

  Fly   221 SGVGKTSLLIRF-RDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYR 284
            ..:||||.|.:: .:.:.|....|.. ||:..:|.:.:.|.|:...||:..|.||.|.......:
plant   115 PEIGKTSFLAKYVGEEKEVEMRELEK-GINCTDKTLYMGGARISYSIWELEGAERSRDQIPVACK 178

  Fly   285 DAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKAD 329
            |:.|:|.::|:|::.|.:::.:|..:.|: :.:..:.|::|.|.|
plant   179 DSVAILFMFDLTSRCTLNSVISWYQQARK-SNQTAIPVMVGTKFD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 34/117 (29%)
RAB 214..378 CDD:197555 34/117 (29%)
SGP2NP_850622.1 Spg1 107..289 CDD:206701 34/118 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.