Sequence 1: | NP_001097658.1 | Gene: | Rab26 / 40359 | FlyBaseID: | FBgn0086913 | Length: | 410 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017715.1 | Gene: | zgc:112183 / 550410 | ZFINID: | ZDB-GENE-050417-216 | Length: | 230 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 125/196 - (63%) |
---|---|---|---|
Similarity: | 161/196 - (82%) | Gaps: | 2/196 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 FDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQE 273
Fly 274 RFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVK 338
Fly 339 REDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNTKARSV 403
Fly 404 C 404 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rab26 | NP_001097658.1 | Rab26 | 214..407 | CDD:206695 | 122/191 (64%) |
RAB | 214..378 | CDD:197555 | 113/163 (69%) | ||
zgc:112183 | NP_001017715.1 | Rab26 | 36..226 | CDD:206695 | 122/192 (64%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1018397at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |