DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and zgc:112183

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001017715.1 Gene:zgc:112183 / 550410 ZFINID:ZDB-GENE-050417-216 Length:230 Species:Danio rerio


Alignment Length:196 Identity:125/196 - (63%)
Similarity:161/196 - (82%) Gaps:2/196 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 FDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQE 273
            |||..||::||||.||||.:|:||:||.::...|::|||||||||||.||..:||||||||||||
Zfish    32 FDIAFKVMLLGDSAVGKTCVLVRFKDGAFLGGNFIATVGIDFRNKVVTVDNMKVKLQIWDTAGQE 96

  Fly   274 RFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVK 338
            |||||||||||||.|||||||:|.|:::|||||||.||.||||:||||:|:|||:|.: :||.:.
Zfish    97 RFRSVTHAYYRDAQALLLLYDITRKSSFDNIRAWLTEIYEYAQKDVVIMLLGNKSDMA-AERVIT 160

  Fly   339 REDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNTKARSV 403
            .|:||:|.:|:.|||||||||||:||||:|.|:||:||.|..|...:.||.:||:: ::.|.:|.
Zfish   161 HEEGEKLAKEYGVPFMETSAKTGVNVELAFHAIARELKHRNLEQPHEPKFKIHDYI-ESQKQKSN 224

  Fly   404 C 404
            |
Zfish   225 C 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 122/191 (64%)
RAB 214..378 CDD:197555 113/163 (69%)
zgc:112183NP_001017715.1 Rab26 36..226 CDD:206695 122/192 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1018397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.