DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and rab18

DIOPT Version :10

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001017281.1 Gene:rab18 / 550035 XenbaseID:XB-GENE-489852 Length:206 Species:Xenopus tropicalis


Alignment Length:52 Identity:12/52 - (23%)
Similarity:20/52 - (38%) Gaps:15/52 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GMLIDIVDEEWMRDTLPDDDLPLPPVLAVKTDDTEETNQETQQADAETWRDL 58
            |:||.::     |.....||:          :|.|......::|..:..|||
 Frog    22 GLLISVI-----RTLSTSDDV----------EDRENEKGRLEEAYEKCDRDL 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695
rab18NP_001017281.1 Rab18 9..169 CDD:206656 12/52 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.