DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab18

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster


Alignment Length:194 Identity:72/194 - (37%)
Similarity:119/194 - (61%) Gaps:8/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSV 278
            |::::|:|||||:||:.||.:.::..::.: |:|:||::||:.|||...|:.:|||||.|||||:
  Fly     7 KLLVIGESGVGKSSLIRRFVENKFDQNHDV-TIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSL 70

  Fly   279 THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQE-DVVIVLIGNKADCSGSERQVKREDG 342
            |.::||.|...:|:||:|::.:...:..||.|:..|:.. ::.|:::|||.|   .||.|.||:|
  Fly    71 TPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID---EERVVDREEG 132

  Fly   343 ERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFV--RDNTKARSVC 404
            .:..|:|...|:|||||....|...|..|..::.|..|.:..:....: |..  ||...:.|.|
  Fly   133 RKFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNGNASAGL-DIASDRDLEASASTC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 72/194 (37%)
RAB 214..378 CDD:197555 65/164 (40%)
Rab18NP_524744.2 RAB 6..166 CDD:197555 65/162 (40%)
Rab18 6..165 CDD:206656 65/161 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.