DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and RabX4

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster


Alignment Length:186 Identity:87/186 - (46%)
Similarity:129/186 - (69%) Gaps:8/186 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSV 278
            ||::||||.||||.::.|:.|.:|..:| :||:||||:.|::.:||..:||||||||||||||::
  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTY-ISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTL 73

  Fly   279 THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGE 343
            |.||||.|..:||:|||||..:|:|:..||..|:|.|..|||.||.|||.:||.::|.|.:|.||
  Fly    74 TTAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQENASPDVVKVLAGNKCECSATQRMVDKERGE 138

  Fly   344 RLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNTK 399
            ::....::||.|.|.|:.:|:|.:|.::||:::.:....||       :|..|.:|
  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGD-------NFDNDESK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 87/186 (47%)
RAB 214..378 CDD:197555 82/163 (50%)
RabX4NP_733043.1 RAB 9..170 CDD:197555 82/160 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.