DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and RAB8A

DIOPT Version :10

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_005361.2 Gene:RAB8A / 4218 HGNCID:7007 Length:207 Species:Homo sapiens


Alignment Length:61 Identity:14/61 - (22%)
Similarity:28/61 - (45%) Gaps:7/61 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEVSLGMLIDIVDEEWMRDTLPDDDLPLPPVLAVKTDDTEETNQETQQADAETWRDLALDT 62
            :||::.:...:.:..|.:.|    ..|...:..:.:.:...:.:|||  .|||.:.|. ||
Human  1839 SEVNVTVSTTVPESRWAQST----QHPTETLQEIGSPNPSYSGEETQ--TAETAKSLT-DT 1892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695
RAB8ANP_005361.2 Rab8_Rab10_Rab13_like 6..172 CDD:206659
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 31..45
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 63..80
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.