DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab8

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001246837.1 Gene:Rab8 / 40168 FlyBaseID:FBgn0262518 Length:207 Species:Drosophila melanogaster


Alignment Length:170 Identity:78/170 - (45%)
Similarity:123/170 - (72%) Gaps:2/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 FDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQE 273
            :|.:.|::::||||||||.:|.||.:..: .:.|:||:||||:.:.:.:|..::|||||||||||
  Fly     5 YDYLFKLLLIGDSGVGKTCILFRFSEDAF-NTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQE 68

  Fly   274 RFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVK 338
            |||::|.||||.|..::|:||:|.:.:::||:.|:..|.|.|..||..:|:|||.:.: .:|||.
  Fly    69 RFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELT-DKRQVS 132

  Fly   339 REDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR 378
            :|.||:|..|:.:.|||||||..:|||.:|..:|..:|::
  Fly   133 KERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 77/165 (47%)
RAB 214..378 CDD:197555 77/163 (47%)
Rab8NP_001246837.1 Rab8_Rab10_Rab13_like 6..172 CDD:206659 78/167 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.