DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and RabX5

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_647644.2 Gene:RabX5 / 38209 FlyBaseID:FBgn0035255 Length:277 Species:Drosophila melanogaster


Alignment Length:202 Identity:62/202 - (30%)
Similarity:102/202 - (50%) Gaps:26/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSV 278
            |||.:||..||||:::.||...::..:| .:|:|:||..:...:.|....|::||||||||||.:
  Fly    66 KVIFVGDCSVGKTAIVNRFCYDKFQSNY-KATIGVDFELENFSILGHNYSLEMWDTAGQERFRCI 129

  Fly   279 THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREY-AQEDVVIVLIGNKADCSGSERQVKREDG 342
            ..||||:|..:::.||::.|.:.::.:.||.....| |.:..::.|:|.|||....|..|:.   
  Fly   130 AGAYYRNASVIVVTYDMSKKDSLESAKKWLNSALNYNASKRPLVFLVGTKADLLSKEEFVRM--- 191

  Fly   343 ERL----GREHNVPFMETSAKTGLNVELSFTAVA------------RQLKSRGYEHGDDGK---- 387
            |||    ..|....:...||::|..|...|..:|            |.:|::..|......    
  Fly   192 ERLAGLAAAELQAEYWSVSARSGFKVTELFQRIAALAFEEAVMQEIRSIKNKPQEQATQASVKSQ 256

  Fly   388 -FNVHDF 393
             |::.:|
  Fly   257 TFDLRNF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 62/202 (31%)
RAB 214..378 CDD:197555 59/180 (33%)
RabX5NP_647644.2 P-loop_NTPase 66..230 CDD:304359 57/167 (34%)
RAB 66..225 CDD:197555 56/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.