DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and RabX6

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001261219.1 Gene:RabX6 / 38084 FlyBaseID:FBgn0035155 Length:222 Species:Drosophila melanogaster


Alignment Length:166 Identity:60/166 - (36%)
Similarity:97/166 - (58%) Gaps:5/166 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYV-PSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRS 277
            |||:.||.||||:||..||....:: .:...||:|:|..::...|:..::|||:|||.|.||..|
  Fly    10 KVILCGDYGVGKSSLFRRFATNTFITDTDRKSTLGLDHIDREYSVNEKQIKLQLWDTGGMERVAS 74

  Fly   278 VTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDG 342
            ||.:||:.|...:|::.:.|..::.::...|.:|..|| |:..|.:.|||:|..|.|.:|..|:.
  Fly    75 VTSSYYKFAEGAILVFALDNAASFHSLSQHLLDIVTYA-ENAKIFICGNKSDLDGREPEVSDEEV 138

  Fly   343 ERLGRE-HNV--PFMETSAKTGLNVELSFTAVARQL 375
            |....: |::  ...:||.::|..||..|..::|||
  Fly   139 EAFCEQCHSLISATYKTSCRSGAGVEEMFRDISRQL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 60/166 (36%)
RAB 214..378 CDD:197555 60/166 (36%)
RabX6NP_001261219.1 RAB 10..176 CDD:197555 60/166 (36%)
Rab 10..172 CDD:206640 57/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.