DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab3

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001356961.1 Gene:Rab3 / 36127 FlyBaseID:FBgn0005586 Length:220 Species:Drosophila melanogaster


Alignment Length:163 Identity:74/163 - (45%)
Similarity:111/163 - (68%) Gaps:2/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 EDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTA 270
            :..||.|.|::::|:|.|||||.|.|:.|..:. |.|:|||||||:.|.|.....||||||||||
  Fly    15 DQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFT-SAFVSTVGIDFKVKTVFRHDKRVKLQIWDTA 78

  Fly   271 GQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSER 335
            ||||:|::|.||||.|...:|:|||||:.::::::.|:.:|:.|:.::..::|:|||.|.. .:|
  Fly    79 GQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIKTYSWDNAQVILVGNKCDME-DQR 142

  Fly   336 QVKREDGERLGREHNVPFMETSAKTGLNVELSF 368
            .:..|.|.:|..:..|.|.|||||..:||:..|
  Fly   143 VISFERGRQLADQLGVEFFETSAKENVNVKAVF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 71/155 (46%)
RAB 214..378 CDD:197555 71/155 (46%)
Rab3NP_001356961.1 Rab3 21..185 CDD:206657 72/157 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.