DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab2

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001260732.1 Gene:Rab2 / 35577 FlyBaseID:FBgn0014009 Length:213 Species:Drosophila melanogaster


Alignment Length:179 Identity:82/179 - (45%)
Similarity:130/179 - (72%) Gaps:6/179 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSV 278
            |.|::||:||||:.||::|.|.|:.|.:.| |:|::|..:::.:||.::|||||||||||.|||:
  Fly     8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDL-TIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSI 71

  Fly   279 THAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGE 343
            |.:|||.|...||:||:|.:.|::::..||.:.|:::..::||:|||||:|.. |.|:||:|:||
  Fly    72 TRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNMVIMLIGNKSDLD-SRREVKKEEGE 135

  Fly   344 RLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHD 392
            ...|||.:.||||||:|..|||.:|...|:::    ||...:|.|::::
  Fly   136 AFAREHGLVFMETSARTAANVEEAFINTAKEI----YEKIQEGVFDINN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 82/179 (46%)
RAB 214..378 CDD:197555 78/163 (48%)
Rab2NP_001260732.1 PLN03108 1..213 CDD:178655 82/179 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.