DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab5

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001259925.1 Gene:Rab5 / 33418 FlyBaseID:FBgn0014010 Length:219 Species:Drosophila melanogaster


Alignment Length:224 Identity:82/224 - (36%)
Similarity:131/224 - (58%) Gaps:20/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 VAPGPGSEGASATLCKNAGRALIRMISSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGR 236
            :|..|.|.|||.|     |.|   ...:..:..:..:|    |:::||:|.|||:||::||..|:
  Fly     1 MATTPRSGGASGT-----GTA---QRPNGTSQNKSCQF----KLVLLGESAVGKSSLVLRFVKGQ 53

  Fly   237 YVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTY 301
            : ..|..||:|..|..:.:.::.|.||.:|||||||||:.|:...|||.|.|.:::||:.|:.::
  Fly    54 F-HEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSF 117

  Fly   302 DNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKREDGERLGREHNVPFMETSAKTGLNVEL 366
            ...:.|:.|:.:.|..::||.|.|||||.| :.|.|:.::.::...|:.:.|||||||||:||..
  Fly   118 QRAKTWVKELHKQASPNIVIALAGNKADLS-NIRVVEFDEAKQYAEENGLLFMETSAKTGMNVND 181

  Fly   367 SFTAVARQLKSRGYEHGDDGKFNVHDFVR 395
            .|.|:|::|..      :||..|....:|
  Fly   182 IFLAIAKKLPK------NDGANNQGTSIR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 72/182 (40%)
RAB 214..378 CDD:197555 68/163 (42%)
Rab5NP_001259925.1 Rab5_related 29..191 CDD:206653 68/167 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.