DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab26 and Rab35

DIOPT Version :9

Sequence 1:NP_001097658.1 Gene:Rab26 / 40359 FlyBaseID:FBgn0086913 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001188678.1 Gene:Rab35 / 33014 FlyBaseID:FBgn0031090 Length:201 Species:Drosophila melanogaster


Alignment Length:207 Identity:88/207 - (42%)
Similarity:129/207 - (62%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 FDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKLQIWDTAGQE 273
            ||.:.|::::|||||||:||||||.|..:..|| ::|:|:||:.:.|.::|.|||||||||||||
  Fly     5 FDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSY-ITTIGVDFKIRTVDIEGMRVKLQIWDTAGQE 68

  Fly   274 RFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVV-IVLIGNKADCSGSERQV 337
            |||::|..|||..|.::::|||||..::.|:|.||.||:...  ||| .||:|||.| ....:.|
  Fly    69 RFRTITSTYYRGTHGVIVVYDVTNGESFANVRRWLEEIQNNC--DVVKKVLVGNKND-DPDRKVV 130

  Fly   338 KREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEH------GDDGKFNVHDFVRD 396
            ..||.:|..::.::...|||||..:|||..|.::.||:    .:|      .:..|..:|  ::.
  Fly   131 ITEDAQRFAKQMDIELFETSAKDNINVENMFLSITRQV----LDHKLRTSPNEQQKDTLH--LKP 189

  Fly   397 NTKARSVCAQCR 408
            |.|.......||
  Fly   190 NPKGSKGGKCCR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab26NP_001097658.1 Rab26 214..407 CDD:206695 84/199 (42%)
RAB 214..378 CDD:197555 79/164 (48%)
Rab35NP_001188678.1 Rab35 3..201 CDD:133310 86/205 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.